(data stored in ACNUC29543 zone)

EMBL: CP001044.PE192

CP001044.PE192       Location/Qualifiers
FT   CDS             237827..240382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3305"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; KEGG: bxe:Bxe_B1704 putative ribonucleotide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72461"
FT                   /db_xref="GOA:B2JS84"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS84"
FT                   /protein_id="ACC72461.1"
FT                   /translation="MRDLMADTDNDLSQLNSTTIAPQQFSLDVLMEKYAKGDERTADDV
FT                   YRRVARGVALAEPEALRPAIEARFVENLQNGALGAGRIMSAAGAGIQATLINCFVQPVG
FT                   DSIQGVDDQGLPGIYVALLQAAETMRRGGGVGYNFSAIRPRGARVKTTGSSASGPCSYI
FT                   DVFDASCRTVESAGSRRGAQMAVLDCTHPDLLEFIDAKHSKGRWNNFNVSVAVTDEFMQ
FT                   AVENDAMWQLVHRAEPTPALRAANDVRQRDDGMWVYSERRAKEIFDRIMRSTYDIAEPG
FT                   IVFISRMNDDNNLRAVESIRATNPCGEQPLPPYGCCNLGPLNLTRFVLDPFAQRHGGKP
FT                   SFDWDALAQRTRTQVRFLDDVLDVTLWPLEQQYDESRAKRRIGVGFTGLGDTLVMMGLR
FT                   YNSQEGRDFAVRIAKLMRDEAYRASVELARERGAFPLFNAKQYLQDGTFASRLPDDVKE
FT                   AIRTHGIRNSHLLSIAPTGTVSLAFADNASNGIEPAFSWTYTRTKVMANGSREQFAVED
FT                   HAYRLYRELGGDVGHLPDYFVSALEMSARDHLDMMAAVQPYIDTSISKTVNVPADYPFD
FT                   AFENLYFDAWKGGLKGLATYRPNETLGAVLSVTPQAAPTADDALAEVDLDPLRIAIDHR
FT                   PKGQLPAIIEKVEYLTAAGKKSLYLAVSFIEVTGRVGGEEVTIERPIEFFIPAGQRDES
FT                   QQWITATMRSLSLAARGGFVARNLQDLRKVSWDRGQVRLGDVQRLDGHRSPRWHDSEVA
FT                   ALAYALQQILHRRGFLDAEGNQVPSRLLARAPRDDANLNASSADNALSIAEGSAEEARS
FT                   AQELRTMHGRKCGHCGANAVIRKDGCDFCTACGEIGACG"
     MRDLMADTDN DLSQLNSTTI APQQFSLDVL MEKYAKGDER TADDVYRRVA RGVALAEPEA        60
     LRPAIEARFV ENLQNGALGA GRIMSAAGAG IQATLINCFV QPVGDSIQGV DDQGLPGIYV       120
     ALLQAAETMR RGGGVGYNFS AIRPRGARVK TTGSSASGPC SYIDVFDASC RTVESAGSRR       180
     GAQMAVLDCT HPDLLEFIDA KHSKGRWNNF NVSVAVTDEF MQAVENDAMW QLVHRAEPTP       240
     ALRAANDVRQ RDDGMWVYSE RRAKEIFDRI MRSTYDIAEP GIVFISRMND DNNLRAVESI       300
     RATNPCGEQP LPPYGCCNLG PLNLTRFVLD PFAQRHGGKP SFDWDALAQR TRTQVRFLDD       360
     VLDVTLWPLE QQYDESRAKR RIGVGFTGLG DTLVMMGLRY NSQEGRDFAV RIAKLMRDEA       420
     YRASVELARE RGAFPLFNAK QYLQDGTFAS RLPDDVKEAI RTHGIRNSHL LSIAPTGTVS       480
     LAFADNASNG IEPAFSWTYT RTKVMANGSR EQFAVEDHAY RLYRELGGDV GHLPDYFVSA       540
     LEMSARDHLD MMAAVQPYID TSISKTVNVP ADYPFDAFEN LYFDAWKGGL KGLATYRPNE       600
     TLGAVLSVTP QAAPTADDAL AEVDLDPLRI AIDHRPKGQL PAIIEKVEYL TAAGKKSLYL       660
     AVSFIEVTGR VGGEEVTIER PIEFFIPAGQ RDESQQWITA TMRSLSLAAR GGFVARNLQD       720
     LRKVSWDRGQ VRLGDVQRLD GHRSPRWHDS EVAALAYALQ QILHRRGFLD AEGNQVPSRL       780
     LARAPRDDAN LNASSADNAL SIAEGSAEEA RSAQELRTMH GRKCGHCGAN AVIRKDGCDF       840
     CTACGEIGAC G                                                            851
//

If you have problems or comments...

PBIL Back to PBIL home page