(data stored in ACNUC29543 zone)

EMBL: CP001044.PE195

CP001044.PE195       Location/Qualifiers
FT   CDS             242573..243163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3308"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="TIGRFAM: transcriptional repressor BetI; PFAM:
FT                   regulatory protein TetR; KEGG: bxe:Bxe_B1590
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72464"
FT                   /db_xref="GOA:B2JS87"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JS87"
FT                   /protein_id="ACC72464.1"
FT                   /translation="MPKVGMREVRRAQLIDATLLTIDQSGLSGTTLASVAQRANISTGI
FT                   VSHYFGDKDGLLEATMRHILRDLWAATTRRRIAAKAQPRARLRAIVAANFDVSQVSGPV
FT                   MKTWLAFWSESMHEPALRRLQHVNTRRLYSNLCAEFAKELPRACARRAASGLAAMIDGL
FT                   WLRGALSGDPFDTKAALRLANDYIDLLLAQSAA"
     MPKVGMREVR RAQLIDATLL TIDQSGLSGT TLASVAQRAN ISTGIVSHYF GDKDGLLEAT        60
     MRHILRDLWA ATTRRRIAAK AQPRARLRAI VAANFDVSQV SGPVMKTWLA FWSESMHEPA       120
     LRRLQHVNTR RLYSNLCAEF AKELPRACAR RAASGLAAMI DGLWLRGALS GDPFDTKAAL       180
     RLANDYIDLL LAQSAA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page