(data stored in ACNUC29543 zone)

EMBL: CP001044.PE198

CP001044.PE198       Location/Qualifiers
FT   CDS             246561..247985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3311"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bpd:BURPS668_A1931
FT                   permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72467"
FT                   /db_xref="GOA:B2JS90"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS90"
FT                   /protein_id="ACC72467.1"
FT                   /translation="MPTTASAKRASAAARLERLPFSGYHRTIFIIIAIAFFFDSVDLGT
FT                   MTFVLGSIKTEFGLSSATAGLVASASFFGMVLGAAVAGLFADRFGRRPVFQWSMVLWGV
FT                   ASYLCSTAQSVDALIVYRVLLGIGMGMEFPIAQTLLSEFVPTASRGRLVALMDGFWPLG
FT                   FITAGCVSYFVLPHFGWRTVFALLAIPAVFVLIVRRIVPESPRWLEHRGRLAQADAVLD
FT                   TVEAKVMKSKGLRSLPAASLLAEPAAPSQHGALREIWSAAYRQRTVMVWALWFFALLGF
FT                   YGLTSWLGALMQQAGFAVTKSVLYTVLISLGGVPGFLCAAWLVERWGRKPTCIASLVGG
FT                   GVMAYAYGQTALHADSVTLLICTGLAMQFFLFGMWAVLYTYTPELYGTGARATGSGFAS
FT                   AIGRIGSLIGPYAVGVVLPIFGQGGVFTLGALSFGVAAFAVWVLGIETKGLSLETLVSH
FT                   VDDDASAWRVAADDAR"
     MPTTASAKRA SAAARLERLP FSGYHRTIFI IIAIAFFFDS VDLGTMTFVL GSIKTEFGLS        60
     SATAGLVASA SFFGMVLGAA VAGLFADRFG RRPVFQWSMV LWGVASYLCS TAQSVDALIV       120
     YRVLLGIGMG MEFPIAQTLL SEFVPTASRG RLVALMDGFW PLGFITAGCV SYFVLPHFGW       180
     RTVFALLAIP AVFVLIVRRI VPESPRWLEH RGRLAQADAV LDTVEAKVMK SKGLRSLPAA       240
     SLLAEPAAPS QHGALREIWS AAYRQRTVMV WALWFFALLG FYGLTSWLGA LMQQAGFAVT       300
     KSVLYTVLIS LGGVPGFLCA AWLVERWGRK PTCIASLVGG GVMAYAYGQT ALHADSVTLL       360
     ICTGLAMQFF LFGMWAVLYT YTPELYGTGA RATGSGFASA IGRIGSLIGP YAVGVVLPIF       420
     GQGGVFTLGA LSFGVAAFAV WVLGIETKGL SLETLVSHVD DDASAWRVAA DDAR             474
//

If you have problems or comments...

PBIL Back to PBIL home page