(data stored in ACNUC29543 zone)

EMBL: CP001044.PE2

CP001044.PE2         Location/Qualifiers
FT   CDS             complement(737..1435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr6665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3103"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72271"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR026928"
FT                   /db_xref="InterPro:IPR033468"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR45"
FT                   /protein_id="ACC72271.1"
FT                   /translation="MLTLYSYPDLYGVADNNAFGLKVYAFMRLCGLEFEHRHILDTSHA
FT                   PRGQLPYLSDDGETVGDSDAIIAYLKGRYDLRVDAALSQGQANLDFLVRRTLDDLYWPM
FT                   SYSRWRDERYWPAFRDAVLREHADVTANDLEAAREYNRQRYHYQGIGRYEPDQVYVRGI
FT                   GDLRVVADLLGNSGFVFGPEPATIDAAIYGFVANIYFYEIDTPLKAYVVSRPELVRHCR
FT                   AVHERIAAKA"
     MLTLYSYPDL YGVADNNAFG LKVYAFMRLC GLEFEHRHIL DTSHAPRGQL PYLSDDGETV        60
     GDSDAIIAYL KGRYDLRVDA ALSQGQANLD FLVRRTLDDL YWPMSYSRWR DERYWPAFRD       120
     AVLREHADVT ANDLEAAREY NRQRYHYQGI GRYEPDQVYV RGIGDLRVVA DLLGNSGFVF       180
     GPEPATIDAA IYGFVANIYF YEIDTPLKAY VVSRPELVRH CRAVHERIAA KA               232
//

If you have problems or comments...

PBIL Back to PBIL home page