(data stored in ACNUC29543 zone)

EMBL: CP001044.PE20

CP001044.PE20        Location/Qualifiers
FT   CDS             complement(15886..17373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3121"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B1880 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72289"
FT                   /db_xref="GOA:B2JR63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR63"
FT                   /protein_id="ACC72289.1"
FT                   /translation="MNLLNDESLLSHDRAHAQADAPLYERLAAHYRRVIASGTLAPGDR
FT                   MPSVRALMSRHKVSLSTAIQVFRRLEDGGWLQARPRAGYFVRRPAASKLATVAEPDIPV
FT                   LPEPARYVGLHERISRVIERAQAFPDALNLGGATAGAALYPTERLQSLASRILRHKPTL
FT                   LTEVGEDGGAAELRQAIAKRALTADVTVAPDDVLITSGGVEAVNLALRAVAQPGDTIAV
FT                   ESPAFFGLLQILESLGLRALEIPTSPTTGLSLEALDIALTACPEIKAVVAVPNLQNPLG
FT                   CVMPDTRKAELVALCARRGVALIEDEPYRELVEAAQPARPLKSWDRDGGVIHCASLNKA
FT                   LAPGMRLGWMSSGRWHARVRLLKFAQTRHNESLAQFVAAEFIGSGAYDRHLHRLRDKLR
FT                   VQREASADAIGRYFPAGTRLNLPPGGLLLWVALPDGRSSDALFEAALPHGIRIAPGSIF
FT                   SNSERFRSFIRLSCPVPFDERMDAALRQLGRLAAGIA"
     MNLLNDESLL SHDRAHAQAD APLYERLAAH YRRVIASGTL APGDRMPSVR ALMSRHKVSL        60
     STAIQVFRRL EDGGWLQARP RAGYFVRRPA ASKLATVAEP DIPVLPEPAR YVGLHERISR       120
     VIERAQAFPD ALNLGGATAG AALYPTERLQ SLASRILRHK PTLLTEVGED GGAAELRQAI       180
     AKRALTADVT VAPDDVLITS GGVEAVNLAL RAVAQPGDTI AVESPAFFGL LQILESLGLR       240
     ALEIPTSPTT GLSLEALDIA LTACPEIKAV VAVPNLQNPL GCVMPDTRKA ELVALCARRG       300
     VALIEDEPYR ELVEAAQPAR PLKSWDRDGG VIHCASLNKA LAPGMRLGWM SSGRWHARVR       360
     LLKFAQTRHN ESLAQFVAAE FIGSGAYDRH LHRLRDKLRV QREASADAIG RYFPAGTRLN       420
     LPPGGLLLWV ALPDGRSSDA LFEAALPHGI RIAPGSIFSN SERFRSFIRL SCPVPFDERM       480
     DAALRQLGRL AAGIA                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page