(data stored in ACNUC29543 zone)

EMBL: CP001044.PE201

CP001044.PE201       Location/Qualifiers
FT   CDS             complement(251800..252279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3314"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bte:BTH_II1006
FT                   OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72470"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS93"
FT                   /protein_id="ACC72470.1"
FT                   /translation="MARHTALIEWSSNGSKFTDNRYSRAHQWTFDGGAVVPASSSPHVV
FT                   RVPFSDPAGVDPEEAYIAALSSCHMLWFLSIAVEQGYVVTSYRDAAEGTMAKNDEGKEV
FT                   IARVVLKPAVAFAGAKAPSDEALAHLHHLAHDACFLANSVKTVIDVEGSWSFREP"
     MARHTALIEW SSNGSKFTDN RYSRAHQWTF DGGAVVPASS SPHVVRVPFS DPAGVDPEEA        60
     YIAALSSCHM LWFLSIAVEQ GYVVTSYRDA AEGTMAKNDE GKEVIARVVL KPAVAFAGAK       120
     APSDEALAHL HHLAHDACFL ANSVKTVIDV EGSWSFREP                              159
//

If you have problems or comments...

PBIL Back to PBIL home page