(data stored in ACNUC29543 zone)

EMBL: CP001044.PE205

CP001044.PE205       Location/Qualifiers
FT   CDS             255079..255990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rru:Rru_A2875 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72474"
FT                   /db_xref="GOA:B2JS97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS97"
FT                   /protein_id="ACC72474.1"
FT                   /translation="MVEPDLADLKAFVSVAAARGFRNAASRGGVSASSLSEAIRRLEQQ
FT                   LGVRLLNRTTRSVTPTEAGQRLFERLAPAFGEISTALDAINLFRDSPTGTLRLNVPSIA
FT                   AREILPALLSRFLAGHPGITVEVTSNDTFIDILAAGFDAGIRYDERLERDMIAVPIGPP
FT                   MQRMIAAASPAYLQQHGEPRHPDELVWHACIGHRFESGVLAVWEFTRGDDTVRIVPNGP
FT                   IVASVIDIQLRAAVDGLGIVYSFDEFLRPALDDGTLVPILRDWWQSFTGPRLYYASREH
FT                   MPAPLRAFVDFVLRDNRSRDAG"
     MVEPDLADLK AFVSVAAARG FRNAASRGGV SASSLSEAIR RLEQQLGVRL LNRTTRSVTP        60
     TEAGQRLFER LAPAFGEIST ALDAINLFRD SPTGTLRLNV PSIAAREILP ALLSRFLAGH       120
     PGITVEVTSN DTFIDILAAG FDAGIRYDER LERDMIAVPI GPPMQRMIAA ASPAYLQQHG       180
     EPRHPDELVW HACIGHRFES GVLAVWEFTR GDDTVRIVPN GPIVASVIDI QLRAAVDGLG       240
     IVYSFDEFLR PALDDGTLVP ILRDWWQSFT GPRLYYASRE HMPAPLRAFV DFVLRDNRSR       300
     DAG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page