(data stored in ACNUC29543 zone)

EMBL: CP001044.PE206

CP001044.PE206       Location/Qualifiers
FT   CDS             complement(256007..256270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72475"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS98"
FT                   /protein_id="ACC72475.1"
FT                   /translation="MAIELDKDVRNEAIASLQRYFAENMDEPIGNIQAGALLAFFVEEI
FT                   GPVIYNLAVQDAQQRMHARVAELDIECHEDSFGYWKKYGKRR"
     MAIELDKDVR NEAIASLQRY FAENMDEPIG NIQAGALLAF FVEEIGPVIY NLAVQDAQQR        60
     MHARVAELDI ECHEDSFGYW KKYGKRR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page