(data stored in ACNUC29543 zone)

EMBL: CP001044.PE207

CP001044.PE207       Location/Qualifiers
FT   CDS             complement(256390..257211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3320"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: reh:H16_B1943
FT                   putative non-heme chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72476"
FT                   /db_xref="GOA:B2JS99"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS99"
FT                   /protein_id="ACC72476.1"
FT                   /translation="MSTITTKDGTQIFYKDWGTGRPVVFSHGWPLDADAWDAQMLFLLR
FT                   NGFRVIAHDRRGHGRSDQPATGNDMDTYADDLAALLDALDIQGATLVGHSTGGGEVAHY
FT                   IGRHGTKRVAKAVLIGAVPPLMLKTEANPGGLPMDVFDGIRKGVADNRSQFYKDLAVPF
FT                   FGFNRQGSKVSQGTIDAFWAQGMAGGIHGQFLCIREFSEVDYTEDLKKIDVPTLILHGD
FT                   DDQIVPIDAAGKLSAKIVKNATFKIYEGGAHGMCVTEADKVNADLLAFINS"
     MSTITTKDGT QIFYKDWGTG RPVVFSHGWP LDADAWDAQM LFLLRNGFRV IAHDRRGHGR        60
     SDQPATGNDM DTYADDLAAL LDALDIQGAT LVGHSTGGGE VAHYIGRHGT KRVAKAVLIG       120
     AVPPLMLKTE ANPGGLPMDV FDGIRKGVAD NRSQFYKDLA VPFFGFNRQG SKVSQGTIDA       180
     FWAQGMAGGI HGQFLCIREF SEVDYTEDLK KIDVPTLILH GDDDQIVPID AAGKLSAKIV       240
     KNATFKIYEG GAHGMCVTEA DKVNADLLAF INS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page