(data stored in ACNUC29543 zone)

EMBL: CP001044.PE209

CP001044.PE209       Location/Qualifiers
FT   CDS             complement(259036..259350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syf:Synpcc7942_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72478"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA1"
FT                   /protein_id="ACC72478.1"
FT                   /translation="MKRFHIALAVANLDVSIDDYSRRLGQPPSAVVPGQYAMWRTDLLN
FT                   FSINEKPEQAGQLRHVGFEDDFVDGYSSSVDVNGLEWELFSAAEQDRRIVGTYGVPVKR
FT                   "
     MKRFHIALAV ANLDVSIDDY SRRLGQPPSA VVPGQYAMWR TDLLNFSINE KPEQAGQLRH        60
     VGFEDDFVDG YSSSVDVNGL EWELFSAAEQ DRRIVGTYGV PVKR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page