(data stored in ACNUC29543 zone)

EMBL: CP001044.PE211

CP001044.PE211       Location/Qualifiers
FT   CDS             complement(259923..260909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3324"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: bxe:Bxe_B1753 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72480"
FT                   /db_xref="GOA:B2JSA3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA3"
FT                   /protein_id="ACC72480.1"
FT                   /translation="MSDTKLSHDAPLTAGTPQQRMVELLRTLAPAEGMTDAPLEGVKFL
FT                   RANHPMPRRPVMYEPSIVIVCQGRKRGYLGEQSYIYDAQQYLVLSVPLPFECETEASID
FT                   EPFLGISIRVDLTMVAELLMLLNETHGAVDSEPRGIYSTPLDQPLGDAVLRLLEALVSP
FT                   FDARILAPSIVREICYRVLTGVQGDAIRAALTHQHHFGRIAKALRRIHTEYDGDLDVET
FT                   LARESGMSLAVFHAQFKNVTSTSPMQYVKTTRLHHARLLMVQDGLNASAAAARVGYESA
FT                   SQFSREFKRLFGLSPVDEVKRMRGTLDPVVPPSQRPVTAARKYVTTN"
     MSDTKLSHDA PLTAGTPQQR MVELLRTLAP AEGMTDAPLE GVKFLRANHP MPRRPVMYEP        60
     SIVIVCQGRK RGYLGEQSYI YDAQQYLVLS VPLPFECETE ASIDEPFLGI SIRVDLTMVA       120
     ELLMLLNETH GAVDSEPRGI YSTPLDQPLG DAVLRLLEAL VSPFDARILA PSIVREICYR       180
     VLTGVQGDAI RAALTHQHHF GRIAKALRRI HTEYDGDLDV ETLARESGMS LAVFHAQFKN       240
     VTSTSPMQYV KTTRLHHARL LMVQDGLNAS AAAARVGYES ASQFSREFKR LFGLSPVDEV       300
     KRMRGTLDPV VPPSQRPVTA ARKYVTTN                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page