(data stored in ACNUC29543 zone)

EMBL: CP001044.PE213

CP001044.PE213       Location/Qualifiers
FT   CDS             262534..263493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3326"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B1755 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72482"
FT                   /db_xref="GOA:B2JSA5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA5"
FT                   /protein_id="ACC72482.1"
FT                   /translation="MIDRIQAMRTFMRIVDTNSFTRAAESLEIPRATATTIVQNLEALL
FT                   GTTLLVRTTRRLSLTPEGAAYYERCAQILADIDEMEATLRQTLDNPSGRLRVEMPGAVA
FT                   TSIVLPALDDFHERYPSIDLAIGVSHRNVDLVGEAVDCSIQLGELPDSGLAAKRLGTLE
FT                   HVTCASPAYLERYGMPESLDDLSEHVAVNCMSALTGRAVDFDFDVGGSPLTVKVNGFIK
FT                   VSDEHAYLTCGLQGLGLIQPARIAAQALLDKGLLREVLPQWKPVPMPVSVAYVKGRRVA
FT                   PRVRAFVDWLAELFEHQGHVEADLSRVRMLLQGRLHAV"
     MIDRIQAMRT FMRIVDTNSF TRAAESLEIP RATATTIVQN LEALLGTTLL VRTTRRLSLT        60
     PEGAAYYERC AQILADIDEM EATLRQTLDN PSGRLRVEMP GAVATSIVLP ALDDFHERYP       120
     SIDLAIGVSH RNVDLVGEAV DCSIQLGELP DSGLAAKRLG TLEHVTCASP AYLERYGMPE       180
     SLDDLSEHVA VNCMSALTGR AVDFDFDVGG SPLTVKVNGF IKVSDEHAYL TCGLQGLGLI       240
     QPARIAAQAL LDKGLLREVL PQWKPVPMPV SVAYVKGRRV APRVRAFVDW LAELFEHQGH       300
     VEADLSRVRM LLQGRLHAV                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page