(data stored in ACNUC29543 zone)

EMBL: CP001044.PE214

CP001044.PE214       Location/Qualifiers
FT   CDS             complement(263456..263881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3327"
FT                   /product="polymorphic membrane protein, filamentous
FT                   haemagglutinin/adhesin"
FT                   /note="KEGG: bxe:Bxe_A2858 polymorphic membrane protein,
FT                   filamentous haemagglutinin/adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72483"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA6"
FT                   /protein_id="ACC72483.1"
FT                   /translation="MAVEETATAAGKSAGETRATGRASTKPAHSPLRNLIALMLAIAPP
FT                   LAFAQIVPGGAHAPNVITTQNGVPQVNITQPSSGSRVSVNTYGQFDISKSGAILNNSPT
FT                   IVNAQLAGYINGNPNFGPNDAAQQSIKPHASDPAATS"
     MAVEETATAA GKSAGETRAT GRASTKPAHS PLRNLIALML AIAPPLAFAQ IVPGGAHAPN        60
     VITTQNGVPQ VNITQPSSGS RVSVNTYGQF DISKSGAILN NSPTIVNAQL AGYINGNPNF       120
     GPNDAAQQSI KPHASDPAAT S                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page