(data stored in ACNUC29543 zone)

EMBL: CP001044.PE215

CP001044.PE215       Location/Qualifiers
FT   CDS             complement(264451..264717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72484"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA7"
FT                   /protein_id="ACC72484.1"
FT                   /translation="MSRAQTSELLRRAYESGDGRAAVALLDQSIALGHRKIALIRYLQA
FT                   QHLDAPLDARHHDYVRDVAARMSPATLARVVGEARARAGRRDG"
     MSRAQTSELL RRAYESGDGR AAVALLDQSI ALGHRKIALI RYLQAQHLDA PLDARHHDYV        60
     RDVAARMSPA TLARVVGEAR ARAGRRDG                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page