(data stored in ACNUC29543 zone)

EMBL: CP001044.PE216

CP001044.PE216       Location/Qualifiers
FT   CDS             complement(264726..265139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3329"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: bps:BPSS1365
FT                   putative dihydroneopterin aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72485"
FT                   /db_xref="GOA:B2JSA8"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA8"
FT                   /protein_id="ACC72485.1"
FT                   /translation="MPPPVRGKGWRVFVDELVVSTRIGIHAHEHLAPQPVVIDASLAYR
FT                   CEPSEEGTHAMIDYERYCNRVSEFLSTKTHTRMLETLAVEIAQLSFDEWPALDALTLSL
FT                   YKPKIREGTRRIGVELDWTRADYDVHRTSDVAG"
     MPPPVRGKGW RVFVDELVVS TRIGIHAHEH LAPQPVVIDA SLAYRCEPSE EGTHAMIDYE        60
     RYCNRVSEFL STKTHTRMLE TLAVEIAQLS FDEWPALDAL TLSLYKPKIR EGTRRIGVEL       120
     DWTRADYDVH RTSDVAG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page