(data stored in ACNUC29543 zone)

EMBL: CP001044.PE218

CP001044.PE218       Location/Qualifiers
FT   CDS             complement(265809..268808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3331"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: FAD dependent oxidoreductase; glycine cleavage T
FT                   protein (aminomethyl transferase); FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; Glycine cleavage
FT                   T-protein barrel; KEGG: bch:Bcen2424_5149 sarcosine
FT                   oxidase, alpha subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72487"
FT                   /db_xref="GOA:B2JSB0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB0"
FT                   /protein_id="ACC72487.1"
FT                   /translation="MSQKNRLGAGGRINRAIPLTFTFNGRTYQGFQGDTLASALLANGV
FT                   HFVARSFKYHRPRGIVTADVAEPNAVVQLERGAYTVPNARATEIELYQGLVATSVNAEP
FT                   NLEHDRMAINQKFARFMPAGFYYKTFMWPAKWWPKYEEKIREAAGLGKAPEVLDADRYD
FT                   KCYAHCDVLVVGGGPTGLAAAHAAASSGARVILVDDQRELGGSLLSCKTEIDGHAALSW
FT                   VEKIEAELSRMPDVKILSRSTAFGYQDHNLVTVTQRLTDHQPVSMRKGTRELLWKIRAK
FT                   RVILATGAHERPIVFGNNDLPGVMLASAVSTYIHRFGVMPGRNAVVFTNNDAGYRCALD
FT                   MKACGASVTVVDPRAQGNGALQAAARRHGVKIMNNAAVMTAHGKQRVTSVEVVAYANGK
FT                   TGAKQADLQCDLVAMSGGFSPVLHLFAQSGGKAHWNDTKACFVPGKGMQPETSVGAAAG
FT                   EFSLARGLRLAVDAGVEAVKSIGYAVTRPQVPQVAEVVESPLQPLWLVGSRAEAARGPK
FT                   QFVDFQNDVSAADILLAAREGFESVEHVKRYTAMGFGTDQGKLGNINGMAILADALGKT
FT                   IPETGTTTFRPNYTPVTFGTFAGRELGDLLDPIRKTAVHEWHVENGAMFEDVGNWKRPW
FT                   YFPLKGEDLHAAVKRECLAVRNSVGILDASTLGKIDIQGPDAAKLLNWMYTNPWSKLEV
FT                   GKCRYGLMLDENGMVFDDGVTVRLADQHFMMTTTTGGAARVLTWMERWLQTEWPDMKVR
FT                   LASVTDHWATFAVVGPKSRKVVQKVCSDIDFANEAFPFMSYRNGTVAGVKARVMRISFS
FT                   GELAYEVNVPANMGRAVWEALMAAGAEFDITPYGTETMHVLRAEKGYIIVGQDTDGSVT
FT                   PHDLGMGGLVAKTKDFLGRRSLARSDTTKDNRKQFVGLLSDDPQFVIPEGSQIVARPFQ
FT                   GDTAPMLGHVTSSYYSPILNRSIALAVVKGGLNKMGQSVTIPLSSGKQIAAKIASPVFY
FT                   DTEGVRQHVE"
     MSQKNRLGAG GRINRAIPLT FTFNGRTYQG FQGDTLASAL LANGVHFVAR SFKYHRPRGI        60
     VTADVAEPNA VVQLERGAYT VPNARATEIE LYQGLVATSV NAEPNLEHDR MAINQKFARF       120
     MPAGFYYKTF MWPAKWWPKY EEKIREAAGL GKAPEVLDAD RYDKCYAHCD VLVVGGGPTG       180
     LAAAHAAASS GARVILVDDQ RELGGSLLSC KTEIDGHAAL SWVEKIEAEL SRMPDVKILS       240
     RSTAFGYQDH NLVTVTQRLT DHQPVSMRKG TRELLWKIRA KRVILATGAH ERPIVFGNND       300
     LPGVMLASAV STYIHRFGVM PGRNAVVFTN NDAGYRCALD MKACGASVTV VDPRAQGNGA       360
     LQAAARRHGV KIMNNAAVMT AHGKQRVTSV EVVAYANGKT GAKQADLQCD LVAMSGGFSP       420
     VLHLFAQSGG KAHWNDTKAC FVPGKGMQPE TSVGAAAGEF SLARGLRLAV DAGVEAVKSI       480
     GYAVTRPQVP QVAEVVESPL QPLWLVGSRA EAARGPKQFV DFQNDVSAAD ILLAAREGFE       540
     SVEHVKRYTA MGFGTDQGKL GNINGMAILA DALGKTIPET GTTTFRPNYT PVTFGTFAGR       600
     ELGDLLDPIR KTAVHEWHVE NGAMFEDVGN WKRPWYFPLK GEDLHAAVKR ECLAVRNSVG       660
     ILDASTLGKI DIQGPDAAKL LNWMYTNPWS KLEVGKCRYG LMLDENGMVF DDGVTVRLAD       720
     QHFMMTTTTG GAARVLTWME RWLQTEWPDM KVRLASVTDH WATFAVVGPK SRKVVQKVCS       780
     DIDFANEAFP FMSYRNGTVA GVKARVMRIS FSGELAYEVN VPANMGRAVW EALMAAGAEF       840
     DITPYGTETM HVLRAEKGYI IVGQDTDGSV TPHDLGMGGL VAKTKDFLGR RSLARSDTTK       900
     DNRKQFVGLL SDDPQFVIPE GSQIVARPFQ GDTAPMLGHV TSSYYSPILN RSIALAVVKG       960
     GLNKMGQSVT IPLSSGKQIA AKIASPVFYD TEGVRQHVE                              999
//

If you have problems or comments...

PBIL Back to PBIL home page