(data stored in ACNUC29543 zone)

EMBL: CP001044.PE220

CP001044.PE220       Location/Qualifiers
FT   CDS             complement(269183..270427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3333"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: bvi:Bcep1808_3459
FT                   sarcosine oxidase, beta subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72489"
FT                   /db_xref="GOA:B2JSB2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB2"
FT                   /protein_id="ACC72489.1"
FT                   /translation="MSRYSIFSLFRNGLSYHENWERQWRSPEPKKEYDVVIVGGGGHGL
FT                   ATAYYLAKEHGVKNVAILEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAMKLWEGLS
FT                   QDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPAQIKEIEPTINLN
FT                   SRYPVLGASIQRRAGVARHDAVAWGFARGADQAGVDIIQNCQVTGIRRDGGRVTGVDTV
FT                   KGFIKAKKVAVVAAGNTTTLADMAGIRLPIESHPLQALVSEPIKPVVNSVIMSNAVHAY
FT                   ISQSDKGDLVIGAGVDQYTGFGQRGSFHIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDV
FT                   SPDACPIISKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIANDEPHPLNAPFSLDRFY
FT                   TGHLIDEHGAAAVAH"
     MSRYSIFSLF RNGLSYHENW ERQWRSPEPK KEYDVVIVGG GGHGLATAYY LAKEHGVKNV        60
     AILEKGWIGG GNTARNTTIV RSNYLWDESA ALYEKAMKLW EGLSQDLNYN VMFSQRGVMN       120
     LAHTLQDVRD TERRVNANRL NGVDAEFLTP AQIKEIEPTI NLNSRYPVLG ASIQRRAGVA       180
     RHDAVAWGFA RGADQAGVDI IQNCQVTGIR RDGGRVTGVD TVKGFIKAKK VAVVAAGNTT       240
     TLADMAGIRL PIESHPLQAL VSEPIKPVVN SVIMSNAVHA YISQSDKGDL VIGAGVDQYT       300
     GFGQRGSFHI IEGTLQAIVE MFPVFSRVRM NRQWGGIVDV SPDACPIISK TDVKGLYFNC       360
     GWGTGGFKAT PGSGWVFAHT IANDEPHPLN APFSLDRFYT GHLIDEHGAA AVAH             414
//

If you have problems or comments...

PBIL Back to PBIL home page