(data stored in ACNUC29543 zone)

EMBL: CP001044.PE224

CP001044.PE224       Location/Qualifiers
FT   CDS             274459..275385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3337"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A3026 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72493"
FT                   /db_xref="GOA:B2JKW4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW4"
FT                   /protein_id="ACC72493.1"
FT                   /translation="MNPTELFALLPDMATFARVVDAGNFSEAARQLGSTPSTVSRQIKR
FT                   LEESLGTRLLERSTRRIRVTDAGAQVYRYCRDIVGAASGAVDVAGQSVGEPRGKVSISA
FT                   PIAFARSVIHPLIPEFLRSWPDVDVQLVFADREVDPLRDDVDIVIRLTRSPPLGLAARR
FT                   LGTVRWLLCASPAYLDAHGTPAEPRDLARHECLYLGETVDDNRWHFRRGTQTQSLEVRG
FT                   RYIANHAGARLDAALQHFGIASLPDFVAAQWLRQGDLVQVLAAWEFEARSYMGPVWLLY
FT                   PPNRFLPSKARALIDYLADHLYVAADE"
     MNPTELFALL PDMATFARVV DAGNFSEAAR QLGSTPSTVS RQIKRLEESL GTRLLERSTR        60
     RIRVTDAGAQ VYRYCRDIVG AASGAVDVAG QSVGEPRGKV SISAPIAFAR SVIHPLIPEF       120
     LRSWPDVDVQ LVFADREVDP LRDDVDIVIR LTRSPPLGLA ARRLGTVRWL LCASPAYLDA       180
     HGTPAEPRDL ARHECLYLGE TVDDNRWHFR RGTQTQSLEV RGRYIANHAG ARLDAALQHF       240
     GIASLPDFVA AQWLRQGDLV QVLAAWEFEA RSYMGPVWLL YPPNRFLPSK ARALIDYLAD       300
     HLYVAADE                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page