(data stored in ACNUC29543 zone)

EMBL: CP001044.PE229

CP001044.PE229       Location/Qualifiers
FT   CDS             complement(278728..279645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3343"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bxe:Bxe_B1765 ornithine cyclodeaminase/Mu-crystallin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72498"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW9"
FT                   /protein_id="ACC72498.1"
FT                   /translation="MSTTPIFDAAGTARLIPFRPLVDALKTAAADYAAGRVASPERLVV
FT                   PLNDNGIMLSMPASAADLAIHKLVNVCPRNGERALPTIHGQVMTFDPDTGKTLFILDGP
FT                   TVTGRRTAAMTMLGIETLVHAAPKDILLIGAGTQAASHVQAIGELYPQARVRVRGTSPA
FT                   RAQAFCDAHQGNVRALEPLSDSTIPDSVDTVIALTTSRQAVYDETPRAGRIVIGVGAFT
FT                   PQMCEIGARTLAGSALYVDDLAGAKHEAGDFIQAGINWSTVTGINDALANRPAANLPIV
FT                   FKTVGCAAWDLAAGRVARAALSAG"
     MSTTPIFDAA GTARLIPFRP LVDALKTAAA DYAAGRVASP ERLVVPLNDN GIMLSMPASA        60
     ADLAIHKLVN VCPRNGERAL PTIHGQVMTF DPDTGKTLFI LDGPTVTGRR TAAMTMLGIE       120
     TLVHAAPKDI LLIGAGTQAA SHVQAIGELY PQARVRVRGT SPARAQAFCD AHQGNVRALE       180
     PLSDSTIPDS VDTVIALTTS RQAVYDETPR AGRIVIGVGA FTPQMCEIGA RTLAGSALYV       240
     DDLAGAKHEA GDFIQAGINW STVTGINDAL ANRPAANLPI VFKTVGCAAW DLAAGRVARA       300
     ALSAG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page