(data stored in ACNUC29543 zone)

EMBL: CP001044.PE23

CP001044.PE23        Location/Qualifiers
FT   CDS             complement(19271..19576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_A2282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72292"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR66"
FT                   /protein_id="ACC72292.1"
FT                   /translation="MKAGRLWVGLAALVLTSAAHAEKYVEIWNPPEARGHAAGATAQKP
FT                   VRPHAQKPASPRLARKVTEPGNRPAVQGASSVVSTKRPGNRSIPRKIGPDGNVFRV"
     MKAGRLWVGL AALVLTSAAH AEKYVEIWNP PEARGHAAGA TAQKPVRPHA QKPASPRLAR        60
     KVTEPGNRPA VQGASSVVST KRPGNRSIPR KIGPDGNVFR V                           101
//

If you have problems or comments...

PBIL Back to PBIL home page