(data stored in ACNUC29543 zone)

EMBL: CP001044.PE231

CP001044.PE231       Location/Qualifiers
FT   CDS             complement(280799..281449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72500"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX1"
FT                   /protein_id="ACC72500.1"
FT                   /translation="MSEALPHDEAAFRHRNVPYYTQWGSREWVLPIVEHDADPCEDPDW
FT                   QRCGFDDPERYRFWASRLCGLTCLESALDFWRIAHPTRAALLDAALAHGVYRMRDDGGV
FT                   DGLIYRPFADWVQRTFAIDVDVLPDAPLRDLAGSIGEDAMTIVSVSPEIRYPERPNNAR
FT                   GGHLILLHGRNDDGVWFHNPSGVAPHQADVYLPFDTMERFYARRGMVLKRRPA"
     MSEALPHDEA AFRHRNVPYY TQWGSREWVL PIVEHDADPC EDPDWQRCGF DDPERYRFWA        60
     SRLCGLTCLE SALDFWRIAH PTRAALLDAA LAHGVYRMRD DGGVDGLIYR PFADWVQRTF       120
     AIDVDVLPDA PLRDLAGSIG EDAMTIVSVS PEIRYPERPN NARGGHLILL HGRNDDGVWF       180
     HNPSGVAPHQ ADVYLPFDTM ERFYARRGMV LKRRPA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page