(data stored in ACNUC29543 zone)

EMBL: CP001044.PE233

CP001044.PE233       Location/Qualifiers
FT   CDS             283241..284095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3347"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; BetR domain
FT                   protein; KEGG: bxe:Bxe_B1770 response regulator receiver
FT                   domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72502"
FT                   /db_xref="GOA:B2JKX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX3"
FT                   /protein_id="ACC72502.1"
FT                   /translation="MSNEATSPDSLAVAERVRELMSRHGIGKRQQTSELCRILDLSFSQ
FT                   GHRKLRGNSPWTLSQIKKVAEVFGEPAAQLFGAQSLDPGMVGATAQEAVFAIGSIELAC
FT                   TAWIGAPIEAGSRPEFIAWSKHDQWRVVRYDGALYQNAYEVHKIEIYPRRAETDKPLIA
FT                   VVDDDQASADNLRDYLERSGFAAVAIYGLTAFAETLQTQVFDGVVIDWLFGPQTSAEAI
FT                   RTVRASENPDAPIFVLTGELLTGKASESEISDIVRNYDVACYEKPARMAILVADLSKRL
FT                   SRA"
     MSNEATSPDS LAVAERVREL MSRHGIGKRQ QTSELCRILD LSFSQGHRKL RGNSPWTLSQ        60
     IKKVAEVFGE PAAQLFGAQS LDPGMVGATA QEAVFAIGSI ELACTAWIGA PIEAGSRPEF       120
     IAWSKHDQWR VVRYDGALYQ NAYEVHKIEI YPRRAETDKP LIAVVDDDQA SADNLRDYLE       180
     RSGFAAVAIY GLTAFAETLQ TQVFDGVVID WLFGPQTSAE AIRTVRASEN PDAPIFVLTG       240
     ELLTGKASES EISDIVRNYD VACYEKPARM AILVADLSKR LSRA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page