(data stored in ACNUC29543 zone)

EMBL: CP001044.PE236

CP001044.PE236       Location/Qualifiers
FT   CDS             286677..287624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3350"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: bxe:Bxe_B1773
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72505"
FT                   /db_xref="GOA:B2JKX6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX6"
FT                   /protein_id="ACC72505.1"
FT                   /translation="MKKPVLPLTYEQLDHWIDSLQPALLEERFAAAVGILRGGAPLALM
FT                   ASHAVGVPVAFLSYDRRARHVTWDSAQPLPPPGSKVLLCEDIAGRGFTLVDCIAFLEQH
FT                   GLIVKTLTGAFDEISRIRPDYANDASGFFALFPWERQAYTDDYREDWLKVESGSAAKMA
FT                   EDHEYATYAIDLDGILLPDVPLSRYDEDLAAALNERDALLPFDVLPHVDLQKVRAVITG
FT                   RPHADLTRTRAWLERHGFGHLELVMRMPDSHDETPEGAAAHKAAAALRCGVTHFVESDP
FT                   VQALYIAKLAPLLRVIWWDAAKHKGTLIAASAWR"
     MKKPVLPLTY EQLDHWIDSL QPALLEERFA AAVGILRGGA PLALMASHAV GVPVAFLSYD        60
     RRARHVTWDS AQPLPPPGSK VLLCEDIAGR GFTLVDCIAF LEQHGLIVKT LTGAFDEISR       120
     IRPDYANDAS GFFALFPWER QAYTDDYRED WLKVESGSAA KMAEDHEYAT YAIDLDGILL       180
     PDVPLSRYDE DLAAALNERD ALLPFDVLPH VDLQKVRAVI TGRPHADLTR TRAWLERHGF       240
     GHLELVMRMP DSHDETPEGA AAHKAAAALR CGVTHFVESD PVQALYIAKL APLLRVIWWD       300
     AAKHKGTLIA ASAWR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page