(data stored in ACNUC29543 zone)

EMBL: CP001044.PE237

CP001044.PE237       Location/Qualifiers
FT   CDS             complement(287700..289373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3351"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: bxe:Bxe_B1774
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72506"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX7"
FT                   /protein_id="ACC72506.1"
FT                   /translation="MARIVPDDWKSLATTGAAARERETLALLEEALPRDYTVYHGVHWT
FT                   RLHEGFSVFGEADFVIVSPSGRVMIVEQKTGFLRETPKGLVKVYMQTERNVAIALARTI
FT                   EGLHRRFTAAFGAGTYFIEELLYCPDHVVRDAAIAGVNPARIVDATRKDSLIETIRTAL
FT                   PGDEPRLACASKIHHFLADELALSPDASALVGQAGTLVTRLAGGLATWARRLEFSPFRL
FT                   RVIGTAGSGKTQLAVQVMKDAVARGERPLYVCFNRPLADHIARVAPPQAKIANYHQLCD
FT                   WIVRESGRAPDFQSNDVFDQLESAFAATPIDTGWQYDVLIVDEGQDFQQPWVPALERLL
FT                   KPGGAWWWLEDPLQNLYMREPVALPGWTVLRESTNYRSPRDILGYLRNVVGATVPLAGS
FT                   LTAGGPFDGSDISLSTYDETQTPESCIDATKRAITQALALGFRKQDIAVLSFRGREGSV
FT                   LWPLDHLGPHRLRSFTGKYDLFGNPAYREGDVLLDSIYRFKGQSAPCVILSEVDFDAFD
FT                   ERNARKLFVGATRATMKLIVVASQRAARHLQLGEAKEQVA"
     MARIVPDDWK SLATTGAAAR ERETLALLEE ALPRDYTVYH GVHWTRLHEG FSVFGEADFV        60
     IVSPSGRVMI VEQKTGFLRE TPKGLVKVYM QTERNVAIAL ARTIEGLHRR FTAAFGAGTY       120
     FIEELLYCPD HVVRDAAIAG VNPARIVDAT RKDSLIETIR TALPGDEPRL ACASKIHHFL       180
     ADELALSPDA SALVGQAGTL VTRLAGGLAT WARRLEFSPF RLRVIGTAGS GKTQLAVQVM       240
     KDAVARGERP LYVCFNRPLA DHIARVAPPQ AKIANYHQLC DWIVRESGRA PDFQSNDVFD       300
     QLESAFAATP IDTGWQYDVL IVDEGQDFQQ PWVPALERLL KPGGAWWWLE DPLQNLYMRE       360
     PVALPGWTVL RESTNYRSPR DILGYLRNVV GATVPLAGSL TAGGPFDGSD ISLSTYDETQ       420
     TPESCIDATK RAITQALALG FRKQDIAVLS FRGREGSVLW PLDHLGPHRL RSFTGKYDLF       480
     GNPAYREGDV LLDSIYRFKG QSAPCVILSE VDFDAFDERN ARKLFVGATR ATMKLIVVAS       540
     QRAARHLQLG EAKEQVA                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page