(data stored in ACNUC29543 zone)

EMBL: CP001044.PE238

CP001044.PE238       Location/Qualifiers
FT   CDS             289532..290158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3352"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bxe:Bxe_B1775 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72507"
FT                   /db_xref="GOA:B2JKX8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX8"
FT                   /protein_id="ACC72507.1"
FT                   /translation="MITVWGRANSVNVQKVLWVCDELVLPYHRIDAGLQFGRNDEPRYL
FT                   AMNPTGKVPTLVDGDYVLWESNSILRYLVMQYGASSLLYPEEAKTRASIDRWLDWALST
FT                   LQPAERPVFWAIVRTPAEQRDNAKLAADIDNVSKLWQMLDAQLQGRFFMEGENFTLADV
FT                   VLGAYAKRWFGLPGVERPSLPNLERWYLRLATRSGFKRYVDFDLT"
     MITVWGRANS VNVQKVLWVC DELVLPYHRI DAGLQFGRND EPRYLAMNPT GKVPTLVDGD        60
     YVLWESNSIL RYLVMQYGAS SLLYPEEAKT RASIDRWLDW ALSTLQPAER PVFWAIVRTP       120
     AEQRDNAKLA ADIDNVSKLW QMLDAQLQGR FFMEGENFTL ADVVLGAYAK RWFGLPGVER       180
     PSLPNLERWY LRLATRSGFK RYVDFDLT                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page