(data stored in ACNUC29543 zone)

EMBL: CP001044.PE242

CP001044.PE242       Location/Qualifiers
FT   CDS             complement(292338..293081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3356"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B1778
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72511"
FT                   /db_xref="GOA:B2JKY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY2"
FT                   /protein_id="ACC72511.1"
FT                   /translation="MARQAQTGSKAGSKAGSDRTDQPGGVEEAGARARPEPAARRPGRP
FT                   SGSGRGPEQRARLLDAALALFARQGIVDTTLGQVAREAGFTPAMMHYYFKTRDQLLDVL
FT                   IDERFLPLRARLGGSFQAHPDDPVAAITLLAQRLVEVAGHYPWFPPLWIREVISEGGLL
FT                   KLRMHERFGDANQKNGIAYIEKWQRDGKINAALEPSLVFLSVIGLTILPLATSSMWRND
FT                   PARRKLTADDIARHAVALLTQGVAR"
     MARQAQTGSK AGSKAGSDRT DQPGGVEEAG ARARPEPAAR RPGRPSGSGR GPEQRARLLD        60
     AALALFARQG IVDTTLGQVA REAGFTPAMM HYYFKTRDQL LDVLIDERFL PLRARLGGSF       120
     QAHPDDPVAA ITLLAQRLVE VAGHYPWFPP LWIREVISEG GLLKLRMHER FGDANQKNGI       180
     AYIEKWQRDG KINAALEPSL VFLSVIGLTI LPLATSSMWR NDPARRKLTA DDIARHAVAL       240
     LTQGVAR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page