(data stored in ACNUC29543 zone)

EMBL: CP001044.PE246

CP001044.PE246       Location/Qualifiers
FT   CDS             complement(297548..299032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3360"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rme:Rmet_5590 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72515"
FT                   /db_xref="GOA:B2JKY6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY6"
FT                   /protein_id="ACC72515.1"
FT                   /translation="MKLFDLGGAARRRRSHVGAMLAPVPAAVTVLLAGCTVGPDYKGAP
FT                   ATTHVSSFKRAPDGVVQTAPGVAAWWLALGDPQLTALIDAGIANSPDLRAAQARVRQAR
FT                   AGLSQQQSNELPKVGASAAYLRTREPDLSSLSGGSSSSGGRGPIALYLAGFDASWELDL
FT                   FGGTRRAVEAASAQADASQAELADAHVQLAAEIGSAYVGLRDQQQSMAIVRKSAELEAR
FT                   VLTLTEQRRDRGVASQLDVERVRTQVENTRNALIPLDAQIAESLDELAVLTGREPGALD
FT                   DELNASAPLPALPQTIAVGDPAQLLRRRPDVRAAERRLASQSAQIGEREADWFPKVTLF
FT                   GSLAFSAADPGHLVRKNNFTWLAVPYLQWNAFDFGRTKARVDQSRAALDEAQAKYESTV
FT                   LGALRDADVALSRYGHERENVVSLRTVESSATRAATLTEQRYRAGTATALDWLDAERTR
FT                   YTAEQNRIQSDAQLIKDYVALQKSLGLGWEGMVSTQ"
     MKLFDLGGAA RRRRSHVGAM LAPVPAAVTV LLAGCTVGPD YKGAPATTHV SSFKRAPDGV        60
     VQTAPGVAAW WLALGDPQLT ALIDAGIANS PDLRAAQARV RQARAGLSQQ QSNELPKVGA       120
     SAAYLRTREP DLSSLSGGSS SSGGRGPIAL YLAGFDASWE LDLFGGTRRA VEAASAQADA       180
     SQAELADAHV QLAAEIGSAY VGLRDQQQSM AIVRKSAELE ARVLTLTEQR RDRGVASQLD       240
     VERVRTQVEN TRNALIPLDA QIAESLDELA VLTGREPGAL DDELNASAPL PALPQTIAVG       300
     DPAQLLRRRP DVRAAERRLA SQSAQIGERE ADWFPKVTLF GSLAFSAADP GHLVRKNNFT       360
     WLAVPYLQWN AFDFGRTKAR VDQSRAALDE AQAKYESTVL GALRDADVAL SRYGHERENV       420
     VSLRTVESSA TRAATLTEQR YRAGTATALD WLDAERTRYT AEQNRIQSDA QLIKDYVALQ       480
     KSLGLGWEGM VSTQ                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page