(data stored in ACNUC29543 zone)

EMBL: CP001044.PE248

CP001044.PE248       Location/Qualifiers
FT   CDS             complement(300641..301789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3362"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rme:Rmet_5592 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72517"
FT                   /db_xref="GOA:B2JKY8"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY8"
FT                   /protein_id="ACC72517.1"
FT                   /translation="MSATLPVEESGRATRAQRSGKKGVFLLIGGVAVLGAIAWGAHWWT
FT                   MGRFIESTDDAYLQADGMTVAPKVSGYVAEVLVGDNQRVTSGQPLVRLDSRQYDAVLEQ
FT                   ANATIAARRADILRGEAELAQQQAAIAQARAQLDGATANEAHAADQVKRYEPLAATGAE
FT                   TNERVADLRNTQRQASATRAADAAALQSAERQIATTHAAIEQSRAQLAAAEASARQAQL
FT                   DAQDTMVKSPIDGRVGDRSVRVGQYAQPGTRFMTIVPVQDVYLVANFKETQIGMMRIGQ
FT                   PVTLRVDALPGAKLHGTIDSFSPGTGSQFALLPAQNATGNFTKIVQRVPVRIKLDVGPE
FT                   TRKVLLPGLSVNVDVDTRSARNNEARIERENEAHVARENNRG"
     MSATLPVEES GRATRAQRSG KKGVFLLIGG VAVLGAIAWG AHWWTMGRFI ESTDDAYLQA        60
     DGMTVAPKVS GYVAEVLVGD NQRVTSGQPL VRLDSRQYDA VLEQANATIA ARRADILRGE       120
     AELAQQQAAI AQARAQLDGA TANEAHAADQ VKRYEPLAAT GAETNERVAD LRNTQRQASA       180
     TRAADAAALQ SAERQIATTH AAIEQSRAQL AAAEASARQA QLDAQDTMVK SPIDGRVGDR       240
     SVRVGQYAQP GTRFMTIVPV QDVYLVANFK ETQIGMMRIG QPVTLRVDAL PGAKLHGTID       300
     SFSPGTGSQF ALLPAQNATG NFTKIVQRVP VRIKLDVGPE TRKVLLPGLS VNVDVDTRSA       360
     RNNEARIERE NEAHVARENN RG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page