(data stored in ACNUC29543 zone)

EMBL: CP001044.PE251

CP001044.PE251       Location/Qualifiers
FT   CDS             complement(304566..305120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3366"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   bxe:Bxe_B1793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72520"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ1"
FT                   /protein_id="ACC72520.1"
FT                   /translation="MREVRWTPQESEGVEHLAFDARADGFYIESVLVGERDGRAYGLMY
FT                   RVKCDLQWRTLRASLKLVGGAELELHGDGEGNWHDGHGLVLASLAGCIDIDISATPFTN
FT                   TLPVRRLQLAKGAREPIAVAFISVPDLQVSRVEQAYTCIEPGSEYRYEGIDTGFAAELK
FT                   VDGDGLVIDYPTMFTRTLPLV"
     MREVRWTPQE SEGVEHLAFD ARADGFYIES VLVGERDGRA YGLMYRVKCD LQWRTLRASL        60
     KLVGGAELEL HGDGEGNWHD GHGLVLASLA GCIDIDISAT PFTNTLPVRR LQLAKGAREP       120
     IAVAFISVPD LQVSRVEQAY TCIEPGSEYR YEGIDTGFAA ELKVDGDGLV IDYPTMFTRT       180
     LPLV                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page