(data stored in ACNUC29543 zone)

EMBL: CP001044.PE253

CP001044.PE253       Location/Qualifiers
FT   CDS             306346..307125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3368"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bur:Bcep18194_B1139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72522"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ3"
FT                   /protein_id="ACC72522.1"
FT                   /translation="MSSFAHTPAGRVAQPKPVSEEERRTRVDLAAAYRLAAVNGWDDLV
FT                   YTHISASVPDEPGHFLINPFGLSFDEVCASNLVKIDIDGNIVGASEHPVNATGFALHAA
FT                   VHAARTDAFCVMHLHNTAGIAVSLQRNGLLPGSQHALRFHGYLAYHDYEGLAFTPAEGE
FT                   RLVSDLGDKPAMLLRNHGTLTTGRTVAEAYVLMATLIKACEIQLLAQAGGGELVLPAEA
FT                   VAERTAEQLYDGGAVEGGIEWPALLRKLDRVDSSFRD"
     MSSFAHTPAG RVAQPKPVSE EERRTRVDLA AAYRLAAVNG WDDLVYTHIS ASVPDEPGHF        60
     LINPFGLSFD EVCASNLVKI DIDGNIVGAS EHPVNATGFA LHAAVHAART DAFCVMHLHN       120
     TAGIAVSLQR NGLLPGSQHA LRFHGYLAYH DYEGLAFTPA EGERLVSDLG DKPAMLLRNH       180
     GTLTTGRTVA EAYVLMATLI KACEIQLLAQ AGGGELVLPA EAVAERTAEQ LYDGGAVEGG       240
     IEWPALLRKL DRVDSSFRD                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page