(data stored in ACNUC29543 zone)

EMBL: CP001044.PE255

CP001044.PE255       Location/Qualifiers
FT   CDS             307971..308936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72524"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ5"
FT                   /protein_id="ACC72524.1"
FT                   /translation="MRDQLIASIATRIADYRRGEIAAPTPEHVERWVNQFPNQQDEILA
FT                   ELDHVLGRTYITETSFRAWIAHFVADANILGPAPADFWAGAQLLANQGGGGSQRHLIQV
FT                   IRETINATFGQLQPRAQVATYVYVDDVSYSGNRILNDIGNWINVAPANASLLIFTIGAH
FT                   AYGKWRVERDLGDAVRASGKNITIRWYSYVTLEDRRAHTDVSDVLRPVQVAGDQTVANY
FT                   VQTFARPVVWRLGTSVGVGELFSSGNARSILEQQLLHAGIRIKNMCQFFGKNHRPLGYT
FT                   NLETLGFGSTIVTYRNCPNNAPLALWAGAPWYPLFPRRIN"
     MRDQLIASIA TRIADYRRGE IAAPTPEHVE RWVNQFPNQQ DEILAELDHV LGRTYITETS        60
     FRAWIAHFVA DANILGPAPA DFWAGAQLLA NQGGGGSQRH LIQVIRETIN ATFGQLQPRA       120
     QVATYVYVDD VSYSGNRILN DIGNWINVAP ANASLLIFTI GAHAYGKWRV ERDLGDAVRA       180
     SGKNITIRWY SYVTLEDRRA HTDVSDVLRP VQVAGDQTVA NYVQTFARPV VWRLGTSVGV       240
     GELFSSGNAR SILEQQLLHA GIRIKNMCQF FGKNHRPLGY TNLETLGFGS TIVTYRNCPN       300
     NAPLALWAGA PWYPLFPRRI N                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page