(data stored in ACNUC29543 zone)

EMBL: CP001044.PE257

CP001044.PE257       Location/Qualifiers
FT   CDS             309684..310010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72526"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ7"
FT                   /protein_id="ACC72526.1"
FT                   /translation="MAIRLYRNGGCMTKGSVTLGDVAARTTHINIACSRCERRGHYRLS
FT                   KLVATLGEDFPVTSLAGQISDCPKQDAPTWEKCDVFYPGLRAIMDGGKPSDTPKPEHGD
FT                   DDDD"
     MAIRLYRNGG CMTKGSVTLG DVAARTTHIN IACSRCERRG HYRLSKLVAT LGEDFPVTSL        60
     AGQISDCPKQ DAPTWEKCDV FYPGLRAIMD GGKPSDTPKP EHGDDDDD                    108
//

If you have problems or comments...

PBIL Back to PBIL home page