(data stored in ACNUC29543 zone)

EMBL: CP001044.PE258

CP001044.PE258       Location/Qualifiers
FT   CDS             310206..310604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72527"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ8"
FT                   /protein_id="ACC72527.1"
FT                   /translation="MKTQNELLDLIADESTPLADAWQAIQDLQTRFIERIARVAIEERA
FT                   DVSALVISQVMQIHKPGKAVVIDPSATLIDSAQAAHLLGVSKKSMSNYASPSTRTAYNF
FT                   PIEPIRDGRRVMWDRAAIEALAAERVIA"
     MKTQNELLDL IADESTPLAD AWQAIQDLQT RFIERIARVA IEERADVSAL VISQVMQIHK        60
     PGKAVVIDPS ATLIDSAQAA HLLGVSKKSM SNYASPSTRT AYNFPIEPIR DGRRVMWDRA       120
     AIEALAAERV IA                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page