(data stored in ACNUC29543 zone)

EMBL: CP001044.PE262

CP001044.PE262       Location/Qualifiers
FT   CDS             312012..313562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3377"
FT                   /product="phage protein"
FT                   /note="KEGG: bch:Bcen2424_0454 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72531"
FT                   /db_xref="InterPro:IPR011202"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL02"
FT                   /protein_id="ACC72531.1"
FT                   /translation="MNLADQLEAHLGQFSSPPYLFVGSGIARRYMGLESWAGLLATQCE
FT                   LHGLPYGFLSTSAKGDLPELASGMARELHPRWWKEEKYKESRAQFEKFAINEESALKFE
FT                   IAKYIKDNANVIADPDLAAELDLFKQIVVDGIVTTNWDGLLEALFPDYDVYVGQEALLF
FT                   AHIQGIGEIYKIHGSFEDPNSLVLTSADYGEFHRKNPYLASKLLTFFVENPIVFIGYSL
FT                   TDPNILDIIHSVLDCLSPKNVEKLGDRLVFVHWDKDSKEDRFERTILSKNGRTLPVFQA
FT                   TTNSMSSVLGGLTRIKRKIPAKVLRMLKKQVYELVHATIPSERVYVQDIDANTDLDKVE
FT                   FAIGVGIQERLREKGYTALSRVDIARDVIFSNGGYRADMIVRDTLPALLKGMEYVPVFK
FT                   YLHEASAVPKWNPASVSQRVIKASKADLKKFQPKGIGKITAATLEAYDGDFATYTKQHD
FT                   RETVINRAGMLPWEKLNATELQQFLADNIDLMSSDNITVTTNFFKLVCIYDWLAFGQL"
     MNLADQLEAH LGQFSSPPYL FVGSGIARRY MGLESWAGLL ATQCELHGLP YGFLSTSAKG        60
     DLPELASGMA RELHPRWWKE EKYKESRAQF EKFAINEESA LKFEIAKYIK DNANVIADPD       120
     LAAELDLFKQ IVVDGIVTTN WDGLLEALFP DYDVYVGQEA LLFAHIQGIG EIYKIHGSFE       180
     DPNSLVLTSA DYGEFHRKNP YLASKLLTFF VENPIVFIGY SLTDPNILDI IHSVLDCLSP       240
     KNVEKLGDRL VFVHWDKDSK EDRFERTILS KNGRTLPVFQ ATTNSMSSVL GGLTRIKRKI       300
     PAKVLRMLKK QVYELVHATI PSERVYVQDI DANTDLDKVE FAIGVGIQER LREKGYTALS       360
     RVDIARDVIF SNGGYRADMI VRDTLPALLK GMEYVPVFKY LHEASAVPKW NPASVSQRVI       420
     KASKADLKKF QPKGIGKITA ATLEAYDGDF ATYTKQHDRE TVINRAGMLP WEKLNATELQ       480
     QFLADNIDLM SSDNITVTTN FFKLVCIYDW LAFGQL                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page