(data stored in ACNUC29543 zone)

EMBL: CP001044.PE264

CP001044.PE264       Location/Qualifiers
FT   CDS             complement(314044..314259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72533"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL04"
FT                   /protein_id="ACC72533.1"
FT                   /translation="MKTQLLIALRILAPVLVVLASACTLVFVRGDGNSFADTRGDTKGQ
FT                   LTVNRRAAKGPASETEPPIVIPHKSR"
     MKTQLLIALR ILAPVLVVLA SACTLVFVRG DGNSFADTRG DTKGQLTVNR RAAKGPASET        60
     EPPIVIPHKS R                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page