(data stored in ACNUC29543 zone)

EMBL: CP001044.PE268

CP001044.PE268       Location/Qualifiers
FT   CDS             complement(318854..319423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3383"
FT                   /product="lambda tail assembly I"
FT                   /note="PFAM: lambda tail assembly I; KEGG: rso:RSc1696
FT                   probable phage HK022 GP20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72537"
FT                   /db_xref="GOA:B2JL08"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL08"
FT                   /protein_id="ACC72537.1"
FT                   /translation="MLTVLFYGDLRRRFGRRYVLDVHSPREAILALCLQLDGLRRYFRD
FT                   HATQNFLVRGYQDYDESDLDYPQSTGTLKVVPLVAGAGAWGKIIGGAALAVVGFVISPY
FT                   SGGLGMALVSMGLSMALGGVAQMLAPRASGSATPEKADNQPSLAFDGAVNTTGQGGPVP
FT                   LGYGRMIVGSQVISVGFSTNNEIVVN"
     MLTVLFYGDL RRRFGRRYVL DVHSPREAIL ALCLQLDGLR RYFRDHATQN FLVRGYQDYD        60
     ESDLDYPQST GTLKVVPLVA GAGAWGKIIG GAALAVVGFV ISPYSGGLGM ALVSMGLSMA       120
     LGGVAQMLAP RASGSATPEK ADNQPSLAFD GAVNTTGQGG PVPLGYGRMI VGSQVISVGF       180
     STNNEIVVN                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page