(data stored in ACNUC29543 zone)

EMBL: CP001044.PE27

CP001044.PE27        Location/Qualifiers
FT   CDS             complement(23724..25031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3128"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc1080 putative hexuronate transporter transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3128"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72296"
FT                   /db_xref="GOA:B2JRG9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRG9"
FT                   /protein_id="ACC72296.1"
FT                   /translation="METQLKTIIGLRWWIIALVCLGTIVNYLSRNALGVMAPELKTLLH
FT                   MNTQQYSYVVGAFQIGYTIMQPVCGLVIDLIGLRLGFALFACLWSATGMLHGLASGWLS
FT                   LAALRGLMGLSEAVAIPAGMKVVAEWFPNREKSVAVGYFNAGTSLGSLFAPPLVVFLSL
FT                   RYGWQSAFAVTGAMGFVWAALWYVFYRAPADHKRISDKERATITEGQTPPAAYAQDKRR
FT                   IREVLGTRRFWAIAQARFFAEPAWQTFSFWIPLYLATERHMDLKQIALFAWLPFLAADL
FT                   GGLFGGYLSPFLMKRLRVPLIWSRIAGVVLGAFMMIGPACIGLVASPYEAIALFCVGGF
FT                   AHQMISALVNTLAADVFEPGEVGTAAGFAGMAAWIGGLGFSLMVGALADKIGYTPLFGA
FT                   LGAFDLIGAALLVILMRGVTRDARLQRVGNGAGSAA"
     METQLKTIIG LRWWIIALVC LGTIVNYLSR NALGVMAPEL KTLLHMNTQQ YSYVVGAFQI        60
     GYTIMQPVCG LVIDLIGLRL GFALFACLWS ATGMLHGLAS GWLSLAALRG LMGLSEAVAI       120
     PAGMKVVAEW FPNREKSVAV GYFNAGTSLG SLFAPPLVVF LSLRYGWQSA FAVTGAMGFV       180
     WAALWYVFYR APADHKRISD KERATITEGQ TPPAAYAQDK RRIREVLGTR RFWAIAQARF       240
     FAEPAWQTFS FWIPLYLATE RHMDLKQIAL FAWLPFLAAD LGGLFGGYLS PFLMKRLRVP       300
     LIWSRIAGVV LGAFMMIGPA CIGLVASPYE AIALFCVGGF AHQMISALVN TLAADVFEPG       360
     EVGTAAGFAG MAAWIGGLGF SLMVGALADK IGYTPLFGAL GAFDLIGAAL LVILMRGVTR       420
     DARLQRVGNG AGSAA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page