(data stored in ACNUC29543 zone)

EMBL: CP001044.PE270

CP001044.PE270       Location/Qualifiers
FT   CDS             complement(320152..320850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3385"
FT                   /product="phage minor tail protein L"
FT                   /note="TIGRFAM: phage minor tail protein L; PFAM: minor
FT                   tail protein L; KEGG: ypp:YPDSF_4037 phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72539"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL10"
FT                   /protein_id="ACC72539.1"
FT                   /translation="MKLNGAIQELAPGAVIQLFVLDLSAYHVPSGNEITRFHAGTNEIG
FT                   GDVVWQGNTYQRFPVQATGFEFKGQGTLPRPHFAVSNVGGIISALCREYSDMVGAPVTR
FT                   KRTLARYLDAVNFADGNPLADPTEGFPDDVFYVNQKLRESVDVCEFELAVAFDVQGVQL
FT                   PRRQVICNSCPWEYRGDGCGYAGGPVADINDNPTSDPNRDACGKRLASCRLRFAGWVPF
FT                   GGFPGAGQYR"
     MKLNGAIQEL APGAVIQLFV LDLSAYHVPS GNEITRFHAG TNEIGGDVVW QGNTYQRFPV        60
     QATGFEFKGQ GTLPRPHFAV SNVGGIISAL CREYSDMVGA PVTRKRTLAR YLDAVNFADG       120
     NPLADPTEGF PDDVFYVNQK LRESVDVCEF ELAVAFDVQG VQLPRRQVIC NSCPWEYRGD       180
     GCGYAGGPVA DINDNPTSDP NRDACGKRLA SCRLRFAGWV PFGGFPGAGQ YR               232
//

If you have problems or comments...

PBIL Back to PBIL home page