(data stored in ACNUC29543 zone)

EMBL: CP001044.PE273

CP001044.PE273       Location/Qualifiers
FT   CDS             complement(323584..323916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72542"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL13"
FT                   /protein_id="ACC72542.1"
FT                   /translation="MTDLSQPVRAFDLTLASETVETECFGAVTISDIGADGIERIASHM
FT                   REAGLSDDREMARQLLCESASGPNGERFTAEGLAHMPARAFRDRIKLLTAAMRVNGLSQ
FT                   VDVEKA"
     MTDLSQPVRA FDLTLASETV ETECFGAVTI SDIGADGIER IASHMREAGL SDDREMARQL        60
     LCESASGPNG ERFTAEGLAH MPARAFRDRI KLLTAAMRVN GLSQVDVEKA                  110
//

If you have problems or comments...

PBIL Back to PBIL home page