(data stored in ACNUC29543 zone)

EMBL: CP001044.PE275

CP001044.PE275       Location/Qualifiers
FT   CDS             complement(324853..325212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72544"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL15"
FT                   /protein_id="ACC72544.1"
FT                   /translation="MTDAELLIILNQALPSRAFLMLAPQGFAEPYLIYQRIWWGPENSL
FT                   CGYMEGDHVRYQIDSYARTHKEAAANMDAALDALRASSDPPNVENGGDLYEQDTKLHRV
FT                   TVNIITWFDPQGVTP"
     MTDAELLIIL NQALPSRAFL MLAPQGFAEP YLIYQRIWWG PENSLCGYME GDHVRYQIDS        60
     YARTHKEAAA NMDAALDALR ASSDPPNVEN GGDLYEQDTK LHRVTVNIIT WFDPQGVTP        119
//

If you have problems or comments...

PBIL Back to PBIL home page