(data stored in ACNUC29543 zone)

EMBL: CP001044.PE277

CP001044.PE277       Location/Qualifiers
FT   CDS             complement(325711..326052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3392"
FT                   /product="phage head-tail adaptor"
FT                   /note="TIGRFAM: phage head-tail adaptor; PFAM: putative
FT                   head-tail adaptor protein; KEGG: asu:Asuc_1242 phage
FT                   head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72546"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL17"
FT                   /protein_id="ACC72546.1"
FT                   /translation="MQAGRLRYRLTFEKPVRLLDETGEVIVDQWVKAFTVWGSLEPLSG
FT                   REYLSASEFRAGITTRVRVRWRSDLDPAMRIRCDEVTYDIAAILPVMGLHKEAQIMCQS
FT                   GVVTTGGQP"
     MQAGRLRYRL TFEKPVRLLD ETGEVIVDQW VKAFTVWGSL EPLSGREYLS ASEFRAGITT        60
     RVRVRWRSDL DPAMRIRCDE VTYDIAAILP VMGLHKEAQI MCQSGVVTTG GQP              113
//

If you have problems or comments...

PBIL Back to PBIL home page