(data stored in ACNUC29543 zone)

EMBL: CP001044.PE279

CP001044.PE279       Location/Qualifiers
FT   CDS             complement(326640..327833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3394"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="KEGG: bpm:BURPS1710b_1682 phage major capsid
FT                   protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72548"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL19"
FT                   /protein_id="ACC72548.1"
FT                   /translation="MDMTEIKKALEETFGQIRDAQTKSLEEVRTELKTLDDKLSKTDIN
FT                   MIDLGQKLAGLSEKGQRETGAQTVGEYFVKSDAFKAMQGGGNAGRARISLEGEQLKAVA
FT                   PIFESVDPNQYPVPSDRRTTIIPPGMNDVWIRDLLPGGTTTSNLIEYPREKAAQLNADY
FT                   QTEGQLKAQSDLSFEMAQAPIVTLAHWLLASRQVLDDVAQLQSYINMRMTYGLRMKEDK
FT                   ELLTGDGATGHIAGLITQAAPFAPTDPALNGVDNIRLAMAQVQAAFYNPTFAVMNPLDW
FT                   ASIQLMKNAQGEYLFGSPLAPVTPRLWNINIDATYAMAQGQFLVGDARQAMVWDRQAIN
FT                   IEVSREDVDNFRRNMVTILVEERLGLSVFAQAAFATGSLVATVAPGGTKSSKSSASA"
     MDMTEIKKAL EETFGQIRDA QTKSLEEVRT ELKTLDDKLS KTDINMIDLG QKLAGLSEKG        60
     QRETGAQTVG EYFVKSDAFK AMQGGGNAGR ARISLEGEQL KAVAPIFESV DPNQYPVPSD       120
     RRTTIIPPGM NDVWIRDLLP GGTTTSNLIE YPREKAAQLN ADYQTEGQLK AQSDLSFEMA       180
     QAPIVTLAHW LLASRQVLDD VAQLQSYINM RMTYGLRMKE DKELLTGDGA TGHIAGLITQ       240
     AAPFAPTDPA LNGVDNIRLA MAQVQAAFYN PTFAVMNPLD WASIQLMKNA QGEYLFGSPL       300
     APVTPRLWNI NIDATYAMAQ GQFLVGDARQ AMVWDRQAIN IEVSREDVDN FRRNMVTILV       360
     EERLGLSVFA QAAFATGSLV ATVAPGGTKS SKSSASA                                397
//

If you have problems or comments...

PBIL Back to PBIL home page