(data stored in ACNUC29543 zone)

EMBL: CP001044.PE28

CP001044.PE28        Location/Qualifiers
FT   CDS             25068..25403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3129"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72297"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH0"
FT                   /protein_id="ACC72297.1"
FT                   /translation="MTDNVRIRTSDAHLSSVIVSPKHLRDTRENHVAHINIGRKAARMA
FT                   HVRSCQRNLPKNDMACVSFAACSFEHQFVLLRAKSNITTPAECAQNRRARAKKVLTFAT
FT                   FILALAR"
     MTDNVRIRTS DAHLSSVIVS PKHLRDTREN HVAHINIGRK AARMAHVRSC QRNLPKNDMA        60
     CVSFAACSFE HQFVLLRAKS NITTPAECAQ NRRARAKKVL TFATFILALA R                111
//

If you have problems or comments...

PBIL Back to PBIL home page