(data stored in ACNUC29543 zone)

EMBL: CP001044.PE281

CP001044.PE281       Location/Qualifiers
FT   CDS             complement(328561..329898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3396"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   portal protein; KEGG: bpm:BURPS1710b_1680 phage portal
FT                   protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72550"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL21"
FT                   /protein_id="ACC72550.1"
FT                   /translation="MADIRYNTPQREMELSVRDPAGWLPRAFNQALTWLGGGWFGGGNV
FT                   DEPGQQINTPTGDYYAGSETQAMQISTVWACVRLITETIGTLSINVYERTPTGRNLVQS
FT                   HPLNYVLNTAPNDRNTPVELLESFGMNLAIDGNCYARIIRDGSGDVISLMPRASQQTTL
FT                   IENTDNTYFYKYSTGGEQITYQPPQMFHSRLMGNGLKGLSPLGYARRSIANALALQNNA
FT                   LRFNAKGGKPAGVLMIDHVLKPEQREAVRNNFADLEAGGDAGSRLFVLEAGMQYQQLTI
FT                   SPADAQMLEQLKFGVDDICRIFRVPSFLVNQYERNTTWGSGIEQMDLGYSKYTLQPYVT
FT                   RLESSMNRWLLRPSEQQRYYVEFNLESLLRSDSASRASFYSTMVQNGLMSRNECRVKEN
FT                   LDRRDGADDLTVQLNLTPIEDLPKVADQNTQQQQQSQDVPTQPIKE"
     MADIRYNTPQ REMELSVRDP AGWLPRAFNQ ALTWLGGGWF GGGNVDEPGQ QINTPTGDYY        60
     AGSETQAMQI STVWACVRLI TETIGTLSIN VYERTPTGRN LVQSHPLNYV LNTAPNDRNT       120
     PVELLESFGM NLAIDGNCYA RIIRDGSGDV ISLMPRASQQ TTLIENTDNT YFYKYSTGGE       180
     QITYQPPQMF HSRLMGNGLK GLSPLGYARR SIANALALQN NALRFNAKGG KPAGVLMIDH       240
     VLKPEQREAV RNNFADLEAG GDAGSRLFVL EAGMQYQQLT ISPADAQMLE QLKFGVDDIC       300
     RIFRVPSFLV NQYERNTTWG SGIEQMDLGY SKYTLQPYVT RLESSMNRWL LRPSEQQRYY       360
     VEFNLESLLR SDSASRASFY STMVQNGLMS RNECRVKENL DRRDGADDLT VQLNLTPIED       420
     LPKVADQNTQ QQQQSQDVPT QPIKE                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page