(data stored in ACNUC29543 zone)

EMBL: CP001044.PE286

CP001044.PE286       Location/Qualifiers
FT   CDS             complement(334208..334924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72555"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL26"
FT                   /protein_id="ACC72555.1"
FT                   /translation="MIPSIWRRRAAAAGFAIVSTSSAYGTAPVVNQGNAYANVPAPTNI
FT                   SAGNFLYAFYVADELTITPTLACSGWTTHRTYQYSGNNNYGFIGALYKVATASEPASYS
FT                   FGGTGVNTFSLCILNMTGVVTSDPFSGVTPTNAKANSATTTFATVTRPRAGAQLLVAVT
FT                   GSSYSPNVANAWTPPASYTLAGQITDLYNQPGKGEAQAAFSAVRTNAPAGATGSMTGTL
FT                   GKSYYNGTMNVVLNTG"
     MIPSIWRRRA AAAGFAIVST SSAYGTAPVV NQGNAYANVP APTNISAGNF LYAFYVADEL        60
     TITPTLACSG WTTHRTYQYS GNNNYGFIGA LYKVATASEP ASYSFGGTGV NTFSLCILNM       120
     TGVVTSDPFS GVTPTNAKAN SATTTFATVT RPRAGAQLLV AVTGSSYSPN VANAWTPPAS       180
     YTLAGQITDL YNQPGKGEAQ AAFSAVRTNA PAGATGSMTG TLGKSYYNGT MNVVLNTG         238
//

If you have problems or comments...

PBIL Back to PBIL home page