(data stored in ACNUC29543 zone)

EMBL: CP001044.PE292

CP001044.PE292       Location/Qualifiers
FT   CDS             complement(338855..339085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swi:Swit_2200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72561"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL32"
FT                   /protein_id="ACC72561.1"
FT                   /translation="MQHECLWPGCGRLIPLAQWGCKAHWYKLPAQLRTRIGRAYRAGVD
FT                   TDTHPTKAWRRAHAAALAWIEQFEAQRASES"
     MQHECLWPGC GRLIPLAQWG CKAHWYKLPA QLRTRIGRAY RAGVDTDTHP TKAWRRAHAA        60
     ALAWIEQFEA QRASES                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page