(data stored in ACNUC29543 zone)

EMBL: CP001044.PE295

CP001044.PE295       Location/Qualifiers
FT   CDS             complement(339805..340266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3410"
FT                   /product="DnaB domain protein helicase domain protein"
FT                   /note="PFAM: DnaB domain protein helicase domain protein;
FT                   KEGG: btl:BALH_4975 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72564"
FT                   /db_xref="GOA:B2JL35"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL35"
FT                   /protein_id="ACC72564.1"
FT                   /translation="MNFENDLRTRAERLVLSALMQDNGSLRHIATLRPSHFSHDTHGQI
FT                   FRHMLALIAKDVPADACSVFASMGHKRQLRKVGLFSYLCEIAALPAIPANIGFYACALT
FT                   SEELVSMALRLAPVLLDPAHDHRISDPGHCHDINRPLVMWAAVEPSTDR"
     MNFENDLRTR AERLVLSALM QDNGSLRHIA TLRPSHFSHD THGQIFRHML ALIAKDVPAD        60
     ACSVFASMGH KRQLRKVGLF SYLCEIAALP AIPANIGFYA CALTSEELVS MALRLAPVLL       120
     DPAHDHRISD PGHCHDINRP LVMWAAVEPS TDR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page