(data stored in ACNUC29543 zone)

EMBL: CP001044.PE296

CP001044.PE296       Location/Qualifiers
FT   CDS             complement(340272..340820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A2361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72565"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL36"
FT                   /protein_id="ACC72565.1"
FT                   /translation="MTRAIPEHWLERLFARMESIYGSRFHDMWRDCEIAEVKATWREGL
FT                   AGITDEGLKRGVAALFHEKSPPTLPRFLELCQPQPAMHMPNRLLTDEVGCTPSHEARAQ
FT                   LAEIAKRIGMREPGIAWARRIFDEAARGHVLPGSRLQVALDAIKSWDATHGAIHREREP
FT                   GCDDEESLVADATTSPEQE"
     MTRAIPEHWL ERLFARMESI YGSRFHDMWR DCEIAEVKAT WREGLAGITD EGLKRGVAAL        60
     FHEKSPPTLP RFLELCQPQP AMHMPNRLLT DEVGCTPSHE ARAQLAEIAK RIGMREPGIA       120
     WARRIFDEAA RGHVLPGSRL QVALDAIKSW DATHGAIHRE REPGCDDEES LVADATTSPE       180
     QE                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page