(data stored in ACNUC29543 zone)

EMBL: CP001044.PE297

CP001044.PE297       Location/Qualifiers
FT   CDS             complement(340801..341724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72566"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL37"
FT                   /protein_id="ACC72566.1"
FT                   /translation="MPRIRTVKPALFQHSTLFDAEHETGLPLRLAYIGLFTCCDREGRF
FT                   KWDERELKLHILPWDDLDFSRVLDALVTRGFVVEYASDTGEKYGWIPTFCKHQVINNRE
FT                   TASELPAPPEPLIQQRSATRDSRVPRACPTRAKRKGRERKGKEVNLKTKGTAQVSGTAS
FT                   RARAKQPPAPPTPSGPATITLAMRKAHISGAQPSNPRIIALAEQGVTPEAVNDACEEAH
FT                   RVHPDESIPVAYVCTILERWQREPQRSNGHGRAYGHASSGFDERAKDRKRAGDELTGRA
FT                   RRAREVDAGDVIDVTATEIGHDPRHS"
     MPRIRTVKPA LFQHSTLFDA EHETGLPLRL AYIGLFTCCD REGRFKWDER ELKLHILPWD        60
     DLDFSRVLDA LVTRGFVVEY ASDTGEKYGW IPTFCKHQVI NNRETASELP APPEPLIQQR       120
     SATRDSRVPR ACPTRAKRKG RERKGKEVNL KTKGTAQVSG TASRARAKQP PAPPTPSGPA       180
     TITLAMRKAH ISGAQPSNPR IIALAEQGVT PEAVNDACEE AHRVHPDESI PVAYVCTILE       240
     RWQREPQRSN GHGRAYGHAS SGFDERAKDR KRAGDELTGR ARRAREVDAG DVIDVTATEI       300
     GHDPRHS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page