(data stored in ACNUC29543 zone)

EMBL: CP001044.PE299

CP001044.PE299       Location/Qualifiers
FT   CDS             342813..343724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3414"
FT                   /product="Phage-related protein predicted endonuclease-like
FT                   protein"
FT                   /note="KEGG: bld:BLi01440 YqaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72568"
FT                   /db_xref="GOA:B2JL39"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL39"
FT                   /protein_id="ACC72568.1"
FT                   /translation="MNTQRDAWLELRRKGIGGSDAAAALGQSRHKTSFQLYQEKTDDTF
FT                   DIVVSSEHAERMRFGQRMEAVIADEYAERYGVKLRRHNRIAHHPRYGFMLANYDRTIDG
FT                   RREGLEAKNVDALSYRFGEWGEPGSDMIPPEYMLQCAHYLSVSGYDVWHLAACIGGNRL
FT                   EVYHVERDAEMIELIEEGEATFWKHIERKEAPSLDYQHASAIPLLKRMYSGTNGATIKL
FT                   PAEAVALHFSKLDFDEQEKLMHAGSEAARARLLHMMGNASIGLLPNGGSYRRKIVERKG
FT                   YEVEPVEYVDFRYSKKGGHGDE"
     MNTQRDAWLE LRRKGIGGSD AAAALGQSRH KTSFQLYQEK TDDTFDIVVS SEHAERMRFG        60
     QRMEAVIADE YAERYGVKLR RHNRIAHHPR YGFMLANYDR TIDGRREGLE AKNVDALSYR       120
     FGEWGEPGSD MIPPEYMLQC AHYLSVSGYD VWHLAACIGG NRLEVYHVER DAEMIELIEE       180
     GEATFWKHIE RKEAPSLDYQ HASAIPLLKR MYSGTNGATI KLPAEAVALH FSKLDFDEQE       240
     KLMHAGSEAA RARLLHMMGN ASIGLLPNGG SYRRKIVERK GYEVEPVEYV DFRYSKKGGH       300
     GDE                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page